Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein automated matches [190420] (9 species) not a true protein |
Species Momordica balsamina [TaxId:3672] [189375] (73 PDB entries) |
Domain d3q9bb_: 3q9b B: [306286] automated match to d4zuoa_ complexed with b3n, dms, k, na, zn |
PDB Entry: 3q9b (more details), 2.25 Å
SCOPe Domain Sequences for d3q9bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q9bb_ d.165.1.1 (B:) automated matches {Momordica balsamina [TaxId: 3672]} mrvifsedhklrnaktelyggelvppfeapfraewilaavkeagfddvvaparhgletvl kvhdagylnfletawdrwkaagykgeaiatsfpvrrtspriptdiegqigyycnaaetai spgtweaalssmasaidgadliaaghkaafslcrppghhagidmfggycfinnaavaaqr lldkgakkiaildvdfhhgngtqdifyergdvffaslhgdpaeafphflgyaeetgkgag agttanypmgrgtpysvwgealtdslkriaafgaeaivvslgvdtfeqdpisffkltspd yitmgrtiaasgvpllvvmeggygvpeiglnvanvlkgvag
Timeline for d3q9bb_: