Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries) |
Domain d3pz8h_: 3pz8 H: [306279] Other proteins in same PDB: d3pz8b2, d3pz8d2, d3pz8e2, d3pz8f2 automated match to d4wipc_ mutant |
PDB Entry: 3pz8 (more details), 2.87 Å
SCOPe Domain Sequences for d3pz8h_:
Sequence, based on SEQRES records: (download)
>d3pz8h_ d.15.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvkee ifddnaklpcfngrvvswlvlaeg
>d3pz8h_ d.15.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dtkiiyhmdetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvkeeif dnaklpcfngrvvswlvlaeg
Timeline for d3pz8h_: