SCOPe 2.07: Domain d3pz8h_: 3pz8 H:

Lineage for d3pz8h_ (3pz8 H:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189205] (16 PDB entries)

8. Domain d3pz8h_: 3pz8 H: [306279]
   Other proteins in same PDB: d3pz8b2, d3pz8d2, d3pz8e2, d3pz8f2
   automated match to d4wipc_
   mutant

Details for d3pz8h_

PDB Entry: 3pz8, 2.87 Å

PDB Description: Crystal structure of Dvl1-DIX(Y17D) mutant

PDB Compounds: (H:) Segment polarity protein dishevelled homolog DVL-1

SCOPe Domain Sequences for d3pz8h_:

Sequence, based on SEQRES records:

>d3pz8h_ d.15.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvkee
ifddnaklpcfngrvvswlvlaeg

Sequence, based on observed residues (ATOM records):

>d3pz8h_ d.15.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dtkiiyhmdetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvkeeif
dnaklpcfngrvvswlvlaeg

Timeline for d3pz8h_:

• d3pz8h_ first appeared in SCOPe 2.06
  
• d3pz8h_ appears in the current release, SCOPe 2.08