Lineage for d3pz8c_ (3pz8 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933417Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)
  8. 2933475Domain d3pz8c_: 3pz8 C: [306271]
    Other proteins in same PDB: d3pz8b2, d3pz8d2, d3pz8e2, d3pz8f2
    automated match to d4wipc_
    mutant

Details for d3pz8c_

PDB Entry: 3pz8 (more details), 2.87 Å

PDB Description: Crystal structure of Dvl1-DIX(Y17D) mutant
PDB Compounds: (C:) Segment polarity protein dishevelled homolog DVL-1

SCOPe Domain Sequences for d3pz8c_:

Sequence, based on SEQRES records: (download)

>d3pz8c_ d.15.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvkee
ifddnaklpcfngrvvswlvla

Sequence, based on observed residues (ATOM records): (download)

>d3pz8c_ d.15.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dtkiiyhmdeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvkeei
fddnaklpcfngrvvswlvla

SCOPe Domain Coordinates for d3pz8c_:

Click to download the PDB-style file with coordinates for d3pz8c_.
(The format of our PDB-style files is described here.)

Timeline for d3pz8c_: