Lineage for d3pl4a1 (3pl4 A:116-336)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340406Superfamily a.118.14: FliG [48029] (2 families) (S)
    fragmented superhelix; consist of 3/4-helical motifs and connecting helices
  5. 2340417Family a.118.14.0: automated matches [191676] (1 protein)
    not a true family
  6. 2340418Protein automated matches [191304] (1 species)
    not a true protein
  7. 2340419Species Helicobacter pylori [TaxId:210] [190009] (4 PDB entries)
  8. 2340424Domain d3pl4a1: 3pl4 A:116-336 [306246]
    Other proteins in same PDB: d3pl4a2, d3pl4b2
    automated match to d3usya_

Details for d3pl4a1

PDB Entry: 3pl4 (more details), 2.71 Å

PDB Description: Crystal structure of FliG (residue 116-343) from H. pylori
PDB Compounds: (A:) flagellar motor switch protein

SCOPe Domain Sequences for d3pl4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pl4a1 a.118.14.0 (A:116-336) automated matches {Helicobacter pylori [TaxId: 210]}
qknfaylgkikpqqladfiinehpqtialilahmeapnaaetlsyfpdemkaeisirman
lgeispqvvkrvstvlenklesltsykievgglravaeifnrlgqksakttlariesvdn
klagaikemmftfedivkldnfaireilkvadkkdlslalktstkdltdkflnnmssraa
eqfveemqylgavkikdvdvaqrkiieivqslqekgviqtg

SCOPe Domain Coordinates for d3pl4a1:

Click to download the PDB-style file with coordinates for d3pl4a1.
(The format of our PDB-style files is described here.)

Timeline for d3pl4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pl4a2