![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.14: FliG [48029] (2 families) ![]() fragmented superhelix; consist of 3/4-helical motifs and connecting helices |
![]() | Family a.118.14.0: automated matches [191676] (1 protein) not a true family |
![]() | Protein automated matches [191304] (1 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [190009] (4 PDB entries) |
![]() | Domain d3pl4a1: 3pl4 A:116-336 [306246] Other proteins in same PDB: d3pl4a2, d3pl4b2 automated match to d3usya_ |
PDB Entry: 3pl4 (more details), 2.71 Å
SCOPe Domain Sequences for d3pl4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pl4a1 a.118.14.0 (A:116-336) automated matches {Helicobacter pylori [TaxId: 210]} qknfaylgkikpqqladfiinehpqtialilahmeapnaaetlsyfpdemkaeisirman lgeispqvvkrvstvlenklesltsykievgglravaeifnrlgqksakttlariesvdn klagaikemmftfedivkldnfaireilkvadkkdlslalktstkdltdkflnnmssraa eqfveemqylgavkikdvdvaqrkiieivqslqekgviqtg
Timeline for d3pl4a1: