| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
| Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein beta-Lactamase, class A [56606] (16 species) |
| Species Bacillus licheniformis [TaxId:1402] [56612] (14 PDB entries) |
| Domain d3kgnb_: 3kgn B: [305699] automated match to d3ly3a_ complexed with bb0, pcz, so4 |
PDB Entry: 3kgn (more details), 2.49 Å
SCOPe Domain Sequences for d3kgnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kgnb_ e.3.1.1 (B:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfcpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln
Timeline for d3kgnb_: