Lineage for d3kgnb_ (3kgn B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2618634Protein beta-Lactamase, class A [56606] (16 species)
  7. 2618635Species Bacillus licheniformis [TaxId:1402] [56612] (14 PDB entries)
  8. 2618659Domain d3kgnb_: 3kgn B: [305699]
    automated match to d3ly3a_
    complexed with bb0, pcz, so4

Details for d3kgnb_

PDB Entry: 3kgn (more details), 2.49 Å

PDB Description: Crystal Structure of fluorophore-labeled Class A Beta-lactamase PenP-E166C in complex with cefotaxime
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3kgnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kgnb_ e.3.1.1 (B:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfcpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

SCOPe Domain Coordinates for d3kgnb_:

Click to download the PDB-style file with coordinates for d3kgnb_.
(The format of our PDB-style files is described here.)

Timeline for d3kgnb_: