Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
Domain d3k46a1: 3k46 A:1-181 [305649] Other proteins in same PDB: d3k46a2, d3k46a3, d3k46a4, d3k46b2, d3k46b3, d3k46b4 automated match to d5czkb1 |
PDB Entry: 3k46 (more details), 2.5 Å
SCOPe Domain Sequences for d3k46a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k46a1 b.18.1.0 (A:1-181) automated matches {Escherichia coli [TaxId: 83333]} mlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfadadi rnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadvtp yviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyttp n
Timeline for d3k46a1:
View in 3D Domains from other chains: (mouse over for more information) d3k46b1, d3k46b2, d3k46b3, d3k46b4 |