Lineage for d3k46a2 (3k46 A:182-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763159Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2763225Domain d3k46a2: 3k46 A:182-273 [305650]
    Other proteins in same PDB: d3k46a1, d3k46a3, d3k46a4, d3k46b1, d3k46b3, d3k46b4
    automated match to d5czkb2

Details for d3k46a2

PDB Entry: 3k46 (more details), 2.5 Å

PDB Description: crystal structure of full-length e. coli beta-glucuronidase
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d3k46a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k46a2 b.1.4.0 (A:182-273) automated matches {Escherichia coli [TaxId: 83333]}
twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl
wqpgegylyelcvtaksqtecdiyplrvgirs

SCOPe Domain Coordinates for d3k46a2:

Click to download the PDB-style file with coordinates for d3k46a2.
(The format of our PDB-style files is described here.)

Timeline for d3k46a2: