SCOPe 2.07: Domain d3h88t1: 3h88 T:1-125

Lineage for d3h88t1 (3h88 T:1-125)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (11 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [189656] (3 PDB entries)

8. Domain d3h88t1: 3h88 T:1-125 [305499]
   Other proteins in same PDB: d3h88a2, d3h88b2, d3h88c2, d3h88d2, d3h88e2, d3h88f2, d3h88g2, d3h88h2, d3h88i2, d3h88j2, d3h88k2, d3h88l2, d3h88m2, d3h88n2, d3h88o2, d3h88p2, d3h88q2, d3h88r2, d3h88t2, d3h88u2, d3h88v2
   automated match to d3qmne_
   complexed with acy, ca, cl, coa, gol, mg, mpd, mrd

Details for d3h88t1

PDB Entry: 3h88, 1.85 Å

PDB Description: Crystal Structure of 4'-Phosphopantetheinyl Transferase AcpS from Vibrio cholerae O1 biovar eltor

PDB Compounds: (T:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d3h88t1:

Sequence; same for both SEQRES and ATOM records:

>d3h88t1 d.150.1.0 (T:1-125) automated matches {Vibrio cholerae [TaxId: 243277]}
mivglgtdiaeiervekalarsgenfarriltdseleqfhaskqqgrflakrfaakeaas
kalgtgiaqgvtfhdftishdklgkpllilsgqaaelasqlqvenihlsisderhyamat
viler

Timeline for d3h88t1:

• d3h88t1 first appeared in SCOPe 2.06
  
• d3h88t1 appears in the current release, SCOPe 2.08