Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
Protein automated matches [191061] (10 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [189656] (3 PDB entries) |
Domain d3h88t1: 3h88 T:1-125 [305499] Other proteins in same PDB: d3h88a2, d3h88b2, d3h88c2, d3h88d2, d3h88e2, d3h88f2, d3h88g2, d3h88h2, d3h88i2, d3h88j2, d3h88k2, d3h88l2, d3h88m2, d3h88n2, d3h88o2, d3h88p2, d3h88q2, d3h88r2, d3h88t2, d3h88u2, d3h88v2 automated match to d3qmne_ complexed with acy, ca, cl, coa, gol, mg, mpd, mrd |
PDB Entry: 3h88 (more details), 1.85 Å
SCOPe Domain Sequences for d3h88t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h88t1 d.150.1.0 (T:1-125) automated matches {Vibrio cholerae [TaxId: 243277]} mivglgtdiaeiervekalarsgenfarriltdseleqfhaskqqgrflakrfaakeaas kalgtgiaqgvtfhdftishdklgkpllilsgqaaelasqlqvenihlsisderhyamat viler
Timeline for d3h88t1:
View in 3D Domains from other chains: (mouse over for more information) d3h88a1, d3h88a2, d3h88b1, d3h88b2, d3h88c1, d3h88c2, d3h88d1, d3h88d2, d3h88e1, d3h88e2, d3h88f1, d3h88f2, d3h88g1, d3h88g2, d3h88h1, d3h88h2, d3h88i1, d3h88i2, d3h88j1, d3h88j2, d3h88k1, d3h88k2, d3h88l1, d3h88l2, d3h88m1, d3h88m2, d3h88n1, d3h88n2, d3h88o1, d3h88o2, d3h88p1, d3h88p2, d3h88q1, d3h88q2, d3h88r1, d3h88r2, d3h88s_, d3h88u1, d3h88u2, d3h88v1, d3h88v2, d3h88w_, d3h88x_ |