Lineage for d1hyua2 (1hyu A:326-451)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2849879Protein Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains [51953] (2 species)
  7. 2849883Species Salmonella typhimurium [TaxId:90371] [51954] (1 PDB entry)
  8. 2849885Domain d1hyua2: 1hyu A:326-451 [30548]
    Other proteins in same PDB: d1hyua3, d1hyua4
    complexed with cl, fad, so4

Details for d1hyua2

PDB Entry: 1hyu (more details), 2 Å

PDB Description: crystal structure of intact ahpf
PDB Compounds: (A:) Alkyl hydroperoxide reductase subunit F

SCOPe Domain Sequences for d1hyua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyua2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Salmonella typhimurium [TaxId: 90371]}
wrnmnvpgedqyrtkgvtycphcdgplfkgkrvavigggnsgveaaidlagivehvtlle
fapemkadqvlqdkvrslknvdiilnaqttevkgdgskvvgleyrdrvsgdihsvalagi
fvqigl

SCOPe Domain Coordinates for d1hyua2:

Click to download the PDB-style file with coordinates for d1hyua2.
(The format of our PDB-style files is described here.)

Timeline for d1hyua2: