Lineage for d1hyua2 (1hyu A:326-451)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 20949Protein Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains [51953] (1 species)
  7. 20950Species Salmonella typhimurium [TaxId:90371] [51954] (1 PDB entry)
  8. 20952Domain d1hyua2: 1hyu A:326-451 [30548]
    Other proteins in same PDB: d1hyua3, d1hyua4

Details for d1hyua2

PDB Entry: 1hyu (more details), 2 Å

PDB Description: crystal structure of intact ahpf

SCOP Domain Sequences for d1hyua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyua2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Salmonella typhimurium}
wrnmnvpgedqyrtkgvtycphcdgplfkgkrvavigggnsgveaaidlagivehvtlle
fapemkadqvlqdkvrslknvdiilnaqttevkgdgskvvgleyrdrvsgdihsvalagi
fvqigl

SCOP Domain Coordinates for d1hyua2:

Click to download the PDB-style file with coordinates for d1hyua2.
(The format of our PDB-style files is described here.)

Timeline for d1hyua2: