Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.2: C-terminal domain of A and B subunits of V1 ATP synthase and A1 ATP sythase [310617] (3 proteins) |
Protein V1 ATP synthase A subunit, C-terminal domain [310709] (2 species) |
Species Thermus thermophilus HB8 [TaxId:300852] [310942] (2 PDB entries) |
Domain d3gqbc4: 3gqb C:432-578 [305436] Other proteins in same PDB: d3gqba1, d3gqba2, d3gqba3, d3gqbb1, d3gqbb2, d3gqbb3, d3gqbc1, d3gqbc2, d3gqbc3, d3gqbd1, d3gqbd2, d3gqbd3 |
PDB Entry: 3gqb (more details), 2.8 Å
SCOPe Domain Sequences for d3gqbc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gqbc4 a.69.1.2 (C:432-578) V1 ATP synthase A subunit, C-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]} tsaldpwyrenvaedypelrdaisellqreaglqeivqlvgpdalqdaerlvievgriir edflqqnayhevdayssmkkaygimkmilafykeaeaaikrgvsideilqlpvlerigra ryvseeefpayfeeamkeiqgafkala
Timeline for d3gqbc4: