Lineage for d3gqbc4 (3gqb C:432-578)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717499Family a.69.1.2: C-terminal domain of A and B subunits of V1 ATP synthase and A1 ATP sythase [310617] (3 proteins)
  6. 2717505Protein V1 ATP synthase A subunit, C-terminal domain [310709] (2 species)
  7. 2717510Species Thermus thermophilus HB8 [TaxId:300852] [310942] (2 PDB entries)
  8. 2717512Domain d3gqbc4: 3gqb C:432-578 [305436]
    Other proteins in same PDB: d3gqba1, d3gqba2, d3gqba3, d3gqbb1, d3gqbb2, d3gqbb3, d3gqbc1, d3gqbc2, d3gqbc3, d3gqbd1, d3gqbd2, d3gqbd3

Details for d3gqbc4

PDB Entry: 3gqb (more details), 2.8 Å

PDB Description: crystal structure of the a3b3 complex from v-atpase
PDB Compounds: (C:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3gqbc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqbc4 a.69.1.2 (C:432-578) V1 ATP synthase A subunit, C-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
tsaldpwyrenvaedypelrdaisellqreaglqeivqlvgpdalqdaerlvievgriir
edflqqnayhevdayssmkkaygimkmilafykeaeaaikrgvsideilqlpvlerigra
ryvseeefpayfeeamkeiqgafkala

SCOPe Domain Coordinates for d3gqbc4:

Click to download the PDB-style file with coordinates for d3gqbc4.
(The format of our PDB-style files is described here.)

Timeline for d3gqbc4: