Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (24 species) not a true protein |
Species Francisella tularensis [TaxId:376619] [311287] (1 PDB entry) |
Domain d3fiua_: 3fiu A: [305382] automated match to d4q16c_ complexed with amp, mg, na, pop |
PDB Entry: 3fiu (more details), 1.85 Å
SCOPe Domain Sequences for d3fiua_:
Sequence, based on SEQRES records: (download)
>d3fiua_ c.26.2.0 (A:) automated matches {Francisella tularensis [TaxId: 376619]} dfspkeysqklvnwlsdscmnypaegfviglsggidsavaaslavktglpttalilpsdn nqhqdmqdaleliemlniehytisiqpayeaflastqsftnlqnnrqlvikgnaqarlrm mylyayaqqynrivigtdnacewymgyftkfgdgaadilplvnlkksqvfelgkyldvpk nildkapsaglwqgqtdedemgvtyqeiddfldgkqvsakalerinfwhnrshhkrklal tpnf
>d3fiua_ c.26.2.0 (A:) automated matches {Francisella tularensis [TaxId: 376619]} dfspkeysqklvnwlsdscmnypaegfviglsggidsavaaslavktglpttalilpsdn nqhqdmqdaleliemlniehytisiqpayeaflastqsftqlvikgnaqarlrmmylyay aqqynrivigtdnacewymgyftkfgdgaadilplvnlkksqvfelgkyldvpknildka psaglwqgqtdedemgvtyqeiddfldgkqvsakalerinfwhnrshhkrklaltpnf
Timeline for d3fiua_: