SCOPe 2.08: Domain d3fiua_: 3fiu A:

Lineage for d3fiua_ (3fiu A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (28 species)
   not a true protein

7. Species Francisella tularensis [TaxId:376619] [311287] (1 PDB entry)

8. Domain d3fiua_: 3fiu A: [305382]
   automated match to d4q16c_
   complexed with amp, mg, na, pop

Details for d3fiua_

PDB Entry: 3fiu, 1.85 Å

PDB Description: structure of nmn synthetase from francisella tularensis

PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d3fiua_:

Sequence, based on SEQRES records:

>d3fiua_ c.26.2.0 (A:) automated matches {Francisella tularensis [TaxId: 376619]}
dfspkeysqklvnwlsdscmnypaegfviglsggidsavaaslavktglpttalilpsdn
nqhqdmqdaleliemlniehytisiqpayeaflastqsftnlqnnrqlvikgnaqarlrm
mylyayaqqynrivigtdnacewymgyftkfgdgaadilplvnlkksqvfelgkyldvpk
nildkapsaglwqgqtdedemgvtyqeiddfldgkqvsakalerinfwhnrshhkrklal
tpnf

Sequence, based on observed residues (ATOM records):

>d3fiua_ c.26.2.0 (A:) automated matches {Francisella tularensis [TaxId: 376619]}
dfspkeysqklvnwlsdscmnypaegfviglsggidsavaaslavktglpttalilpsdn
nqhqdmqdaleliemlniehytisiqpayeaflastqsftqlvikgnaqarlrmmylyay
aqqynrivigtdnacewymgyftkfgdgaadilplvnlkksqvfelgkyldvpknildka
psaglwqgqtdedemgvtyqeiddfldgkqvsakalerinfwhnrshhkrklaltpnf

Timeline for d3fiua_:

• d3fiua_ first appeared in SCOPe 2.06
  
• d3fiua_ appears in SCOPe 2.07