Lineage for d3ei6a1 (3ei6 A:19-426)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505627Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267816] (20 PDB entries)
  8. 2505635Domain d3ei6a1: 3ei6 A:19-426 [305264]
    Other proteins in same PDB: d3ei6a2, d3ei6b2
    automated match to d3ei5a_
    complexed with gol, pl4, so4

Details for d3ei6a1

PDB Entry: 3ei6 (more details), 1.9 Å

PDB Description: crystal structure of ll-diaminopimelate aminotransferase from arabidopsis thaliana complexed with plp-dap: an external aldimine mimic
PDB Compounds: (A:) LL-diaminopimelate aminotransferase

SCOPe Domain Sequences for d3ei6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ei6a1 c.67.1.0 (A:19-426) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvislgigdttepipevitsam
akkahelstiegysgygaeqgakplraaiaktfygglgigdddvfvsdgakcdisrlqvm
fgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygnieymrctpengffpdlstvgr
tdiiffcspnnptgaaatreqltqlvefakkngsiivydsayamymsddnprsifeipga
eevametasfskyagftgvrlgwtvipkkllysdgfpvakdfnriictcfngasnisqag
alacltpegleamhkvigfykentniiidtftslgydvyggknapyvwvhfpnqsswdvf
aeilekthvvttpgsgfgpggegfvrvsafghrenileacrrfkqlyk

SCOPe Domain Coordinates for d3ei6a1:

Click to download the PDB-style file with coordinates for d3ei6a1.
(The format of our PDB-style files is described here.)

Timeline for d3ei6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ei6a2