Lineage for d3b3hg_ (3b3h G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317554Species Mycobacterium smegmatis [TaxId:246196] [188322] (14 PDB entries)
  8. 2317590Domain d3b3hg_: 3b3h G: [305059]
    automated match to d3bkna_
    complexed with epe, fe, hem, mg

Details for d3b3hg_

PDB Entry: 3b3h (more details), 2.72 Å

PDB Description: The structure of Mycobacterial bacterioferritin
PDB Compounds: (G:) bacterioferritin

SCOPe Domain Sequences for d3b3hg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b3hg_ a.25.1.0 (G:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mqgdpdvlkllneqltseltainqyflhskmqdnwgftelaehtraesfeemrhaetitd
rillldglpnyqrlfslrvgqtlreqfeadlaieyevlerlkpgivlcrekqdatsarll
eqiladeethidyletqlqlmdklgdalyaaqcvsrppgsa

SCOPe Domain Coordinates for d3b3hg_:

Click to download the PDB-style file with coordinates for d3b3hg_.
(The format of our PDB-style files is described here.)

Timeline for d3b3hg_: