| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (58 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [188322] (14 PDB entries) |
| Domain d3b3hl_: 3b3h L: [305064] automated match to d3bkna_ complexed with epe, fe, hem, mg |
PDB Entry: 3b3h (more details), 2.72 Å
SCOPe Domain Sequences for d3b3hl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b3hl_ a.25.1.0 (L:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mqgdpdvlkllneqltseltainqyflhskmqdnwgftelaehtraesfeemrhaetitd
rillldglpnyqrlfslrvgqtlreqfeadlaieyevlerlkpgivlcrekqdatsarll
eqiladeethidyletqlqlmdklgdalyaaqcvsrppgsa
Timeline for d3b3hl_: