SCOPe 2.07: Domain d3b2qa1: 3b2q A:11-75

Lineage for d3b2qa1 (3b2q A:11-75)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (17 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:2209] [311241] (3 PDB entries)

8. Domain d3b2qa1: 3b2q A:11-75 [305048]
   Other proteins in same PDB: d3b2qa2, d3b2qa3, d3b2qb2, d3b2qb3
   automated match to d3j9tb1
   complexed with aes, atp, cit; mutant

Details for d3b2qa1

PDB Entry: 3b2q, 2.1 Å

PDB Description: intermediate position of atp on its trail to the binding pocket inside the subunit b mutant r416w of the energy converter a1ao atp synthase

PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3b2qa1:

Sequence, based on SEQRES records:

>d3b2qa1 b.49.1.0 (A:11-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
iagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgvi
ftget

Sequence, based on observed residues (ATOM records):

>d3b2qa1 b.49.1.0 (A:11-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
iagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfeiftget

Timeline for d3b2qa1:

• d3b2qa1 first appeared in SCOPe 2.06
  
• d3b2qa1 appears in the current release, SCOPe 2.08