Lineage for d3b2qa1 (3b2q A:11-75)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067174Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2067393Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2067394Protein automated matches [254527] (11 species)
    not a true protein
  7. 2067484Species Methanosarcina mazei [TaxId:2209] [311241] (3 PDB entries)
  8. 2067485Domain d3b2qa1: 3b2q A:11-75 [305048]
    Other proteins in same PDB: d3b2qa2, d3b2qa3, d3b2qb2, d3b2qb3
    automated match to d3j9tb1
    complexed with aes, atp, cit; mutant

Details for d3b2qa1

PDB Entry: 3b2q (more details), 2.1 Å

PDB Description: intermediate position of atp on its trail to the binding pocket inside the subunit b mutant r416w of the energy converter a1ao atp synthase
PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3b2qa1:

Sequence, based on SEQRES records: (download)

>d3b2qa1 b.49.1.0 (A:11-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
iagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgvi
ftget

Sequence, based on observed residues (ATOM records): (download)

>d3b2qa1 b.49.1.0 (A:11-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
iagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfeiftget

SCOPe Domain Coordinates for d3b2qa1:

Click to download the PDB-style file with coordinates for d3b2qa1.
(The format of our PDB-style files is described here.)

Timeline for d3b2qa1: