SCOPe 2.08: Domain d1fecb2: 1fec B:170-286

Lineage for d1fecb2 (1fec B:170-286)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Trypanothione reductase, middle domain [418955] (3 species)

7. Species Crithidia fasciculata [TaxId:5656] [419411] (6 PDB entries)

8. Domain d1fecb2: 1fec B:170-286 [30492]
   Other proteins in same PDB: d1feca1, d1feca3, d1fecb1, d1fecb3
   complexed with fad

Details for d1fecb2

PDB Entry: 1fec, 1.7 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 1.7 angstrom resolution

PDB Compounds: (B:) trypanothione reductase

SCOPe Domain Sequences for d1fecb2:

Sequence; same for both SEQRES and ATOM records:

>d1fecb2 c.3.1.5 (B:170-286) Trypanothione reductase, middle domain {Crithidia fasciculata [TaxId: 5656]}
gddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgf
dselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigr

Timeline for d1fecb2:

• d1fecb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fecb2 appears in SCOPe 2.07