| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
| Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
| Protein Trypanothione reductase [55429] (3 species) |
| Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries) |
| Domain d1fecb3: 1fec B:358-486 [40177] Other proteins in same PDB: d1feca1, d1feca2, d1fecb1, d1fecb2 complexed with fad |
PDB Entry: 1fec (more details), 1.7 Å
SCOPe Domain Sequences for d1fecb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fecb3 d.87.1.1 (B:358-486) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
ekgkrveki
Timeline for d1fecb3: