SCOPe 2.08: Domain d1geub1: 1geu B:2-146,B:263-335

Lineage for d1geub1 (1geu B:2-146,B:263-335)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Glutathione reductase, N- and C-terminal domain [418942] (3 species)

7. Species Escherichia coli [TaxId:562] [419394] (4 PDB entries)

8. Domain d1geub1: 1geu B:2-146,B:263-335 [30487]
   Other proteins in same PDB: d1geua2, d1geua3, d1geub2, d1geub3
   complexed with fad, nad
   has additional insertions and/or extensions that are not grouped together

Details for d1geub1

PDB Entry: 1geu, 2.2 Å

PDB Description: anatomy of an engineered nad-binding site

PDB Compounds: (B:) glutathione reductase

SCOPe Domain Sequences for d1geub1:

Sequence; same for both SEQRES and ATOM records:

>d1geub1 c.3.1.5 (B:2-146,B:263-335) Glutathione reductase, N- and C-terminal domain {Escherichia coli [TaxId: 562]}
tkhydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqire
aihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvdak
tlevngetitadhiliatggrpshpXrepandninleaagvktnekgyivvdkyqntnie
giyavgdntgaveltpvavaagrrlserlfnnkpdehld

Timeline for d1geub1:

• d1geub1 first appeared (with stable ids) in SCOP 1.55
  
• d1geub1 appears in SCOPe 2.07