SCOPe 2.06: Domain d2yfgf2: 2yfg F:197-447

Lineage for d2yfgf2 (2yfg F:197-447)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187725] (5 PDB entries)

8. Domain d2yfgf2: 2yfg F:197-447 [304759]
   Other proteins in same PDB: d2yfga1, d2yfgb1, d2yfgc1, d2yfgd1, d2yfge1, d2yfgf1
   automated match to d4bhta2
   complexed with gol

Details for d2yfgf2

PDB Entry: 2yfg, 2.5 Å

PDB Description: Structural Determinants of Cofactor Specificity and Domain Flexibility in Bacterial Glutamate Dehydrogenases

PDB Compounds: (F:) NADP-specific glutamate dehydrogenase

SCOPe Domain Sequences for d2yfgf2:

Sequence; same for both SEQRES and ATOM records:

>d2yfgf2 c.2.1.0 (F:197-447) automated matches {Escherichia coli [TaxId: 562]}
kglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaqyaiekamefga
rvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvylegqqpwslpvd
ialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfapgkaanagg
vatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtnyvqganiagfvk
vadamlaqgvi

Timeline for d2yfgf2:

• d2yfgf2 is new in SCOPe 2.06-stable
  
• d2yfgf2 appears in SCOPe 2.07
  
• d2yfgf2 appears in the current release, SCOPe 2.08