PDB entry 2yfg

View 2yfg on RCSB PDB site
Description: Structural Determinants of Cofactor Specificity and Domain Flexibility in Bacterial Glutamate Dehydrogenases
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2011-04-05, released 2012-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yfga1, d2yfga2
  • Chain 'B':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yfgb1, d2yfgb2
  • Chain 'C':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yfgc1, d2yfgc2
  • Chain 'D':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yfgd1, d2yfgd2
  • Chain 'E':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00370 (Start-446)
      • conflict (266)
    Domains in SCOPe 2.06: d2yfge1, d2yfge2
  • Chain 'F':
    Compound: NADP-specific glutamate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yfgf1, d2yfgf2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yfgA (A:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfgA (A:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yfgB (B:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfgB (B:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yfgC (C:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfgC (C:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yfgD (D:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfgD (D:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvlpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfap
    gkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtnyvqg
    aniagfvkvadamlaqgvi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yfgE (E:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssglvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfgE (E:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssglvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yfgF (F:)
    mdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperv
    iqfrvvwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalt
    tlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfma
    gmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgs
    gnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakef
    glvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfq
    qagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggeg
    eqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfgF (F:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi