Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [311258] (1 PDB entry) |
Domain d2xxed2: 2xxe D:165-331 [304679] Other proteins in same PDB: d2xxea1, d2xxeb1, d2xxec1, d2xxed1 automated match to d2v7pa2 mutant |
PDB Entry: 2xxe (more details), 3 Å
SCOPe Domain Sequences for d2xxed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xxed2 d.162.1.0 (D:165-331) automated matches {Thermus thermophilus [TaxId: 300852]} tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargaal spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf
Timeline for d2xxed2: