Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225328] (7 PDB entries) |
Domain d2v7pa2: 2v7p A:165-331 [206262] Other proteins in same PDB: d2v7pa1, d2v7pb1, d2v7pc1, d2v7pd1 automated match to d1llda2 complexed with nad, oxm |
PDB Entry: 2v7p (more details), 2.1 Å
SCOPe Domain Sequences for d2v7pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7pa2 d.162.1.0 (A:165-331) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf
Timeline for d2v7pa2: