Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins) |
Protein Glutathione reductase [51944] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [51945] (17 PDB entries) |
Domain d1gre_1: 1gre 18-165,291-363 [30453] Other proteins in same PDB: d1gre_3 |
PDB Entry: 1gre (more details), 2 Å
SCOP Domain Sequences for d1gre_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gre_1 c.3.1.5 (18-165,291-363) Glutathione reductase {Human (Homo sapiens)} vasydylvigggsgglasarraaelgaraavveshklggtcvnvgcvpkkvmwntavhse fmhdhadygfpscegkfnwrvikekrdayvsrlnaiyqnnltkshieiirghaaftsdpk ptievsgkkytaphiliatggmpstpheXrvpntkdlslnklgiqtddkghiivdefqnt nvkgiyavgdvcgkalltpvaiaagrklahrlfeykedskld
Timeline for d1gre_1: