Lineage for d1gre_1 (1gre 18-165,291-363)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67290Protein Glutathione reductase [51944] (2 species)
  7. 67308Species Human (Homo sapiens) [TaxId:9606] [51945] (16 PDB entries)
  8. 67321Domain d1gre_1: 1gre 18-165,291-363 [30453]
    Other proteins in same PDB: d1gre_3

Details for d1gre_1

PDB Entry: 1gre (more details), 2 Å

PDB Description: substrate binding and catalysis by glutathione reductase as derived from refined enzyme: substrate crystal structures at 2 angstroms resolution

SCOP Domain Sequences for d1gre_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gre_1 c.3.1.5 (18-165,291-363) Glutathione reductase {Human (Homo sapiens)}
vasydylvigggsgglasarraaelgaraavveshklggtcvnvgcvpkkvmwntavhse
fmhdhadygfpscegkfnwrvikekrdayvsrlnaiyqnnltkshieiirghaaftsdpk
ptievsgkkytaphiliatggmpstpheXrvpntkdlslnklgiqtddkghiivdefqnt
nvkgiyavgdvcgkalltpvaiaagrklahrlfeykedskld

SCOP Domain Coordinates for d1gre_1:

Click to download the PDB-style file with coordinates for d1gre_1.
(The format of our PDB-style files is described here.)

Timeline for d1gre_1: