![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Glutathione reductase [51944] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [51945] (17 PDB entries) |
![]() | Domain d1dnca2: 1dnc A:166-290 [30444] Other proteins in same PDB: d1dnca3 complexed with fad, gtt, po4 |
PDB Entry: 1dnc (more details), 1.7 Å
SCOP Domain Sequences for d1dnca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dnca2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl lwaig
Timeline for d1dnca2: