Lineage for d1d4cd2 (1d4c D:103-359,D:506-570)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1154265Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1154266Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1154657Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 1154664Protein Flavocytochrome c3 (respiratory fumarate reductase) [51940] (2 species)
    contains additional N-terminal multiheme domain
  7. 1154689Species Shewanella putrefaciens [TaxId:24] [51942] (3 PDB entries)
  8. 1154694Domain d1d4cd2: 1d4c D:103-359,D:506-570 [30438]
    Other proteins in same PDB: d1d4ca1, d1d4ca3, d1d4cb1, d1d4cb3, d1d4cc1, d1d4cc3, d1d4cd1, d1d4cd3
    complexed with fad, hem, so4

Details for d1d4cd2

PDB Entry: 1d4c (more details), 2.9 Å

PDB Description: crystal structure of the uncomplexed form of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1
PDB Compounds: (D:) flavocytochrome c fumarate reductase

SCOPe Domain Sequences for d1d4cd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4cd2 c.3.1.4 (D:103-359,D:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}
kfvpvdadkaaqdkaiaagvkettdvviigsggaglaaavsardagakvillekepipgg
ntklaaggmnaaetkpqaklgiedkkqimiddtmkggrnindpelvkvlannssdsidwl
tsmgadmtdvgrmggasvnrshrptggagvgahvaqvlwdnavkrgtdirlnsrvvrile
dasgkvtgvlvkgeytgyyvikadavviaaggfaknnervskydpklkgfkatnhpgatg
dgldvalqagaatrdleXmgglvidtkaevksektgkpitglyaagevtggvhganrlgg
naisdivtygriagasaakfakd

SCOPe Domain Coordinates for d1d4cd2:

Click to download the PDB-style file with coordinates for d1d4cd2.
(The format of our PDB-style files is described here.)

Timeline for d1d4cd2: