![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
![]() | Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species) |
![]() | Species Shewanella putrefaciens [TaxId:24] [48723] (3 PDB entries) |
![]() | Domain d1d4cb1: 1d4c B:3-102 [19699] Other proteins in same PDB: d1d4ca2, d1d4ca3, d1d4cb2, d1d4cb3, d1d4cc2, d1d4cc3, d1d4cd2, d1d4cd3 complexed with fad, hem, so4 |
PDB Entry: 1d4c (more details), 2.9 Å
SCOPe Domain Sequences for d1d4cb1:
Sequence, based on SEQRES records: (download)
>d1d4cb1 a.138.1.3 (B:3-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella putrefaciens [TaxId: 24]} evladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsphks hligeiactschkgheksvaycdachsfgfdmpfggkwer
>d1d4cb1 a.138.1.3 (B:3-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella putrefaciens [TaxId: 24]} evladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkvsphkshl igeiactschkgheksvaycdachsfgfdmpfggkwer
Timeline for d1d4cb1: