SCOPe 2.07: Domain d1qo8d2: 1qo8 D:103-359,D:506-565

Lineage for d1qo8d2 (1qo8 D:103-359,D:506-565)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)

6. Protein Flavocytochrome c3 (respiratory fumarate reductase) [51940] (2 species)
   contains additional N-terminal multiheme domain

7. Species Shewanella frigidimarina [TaxId:56812] [51941] (16 PDB entries)

8. Domain d1qo8d2: 1qo8 D:103-359,D:506-565 [30434]
   Other proteins in same PDB: d1qo8a1, d1qo8a3, d1qo8d1, d1qo8d3
   complexed with fad, hem

Details for d1qo8d2

PDB Entry: 1qo8, 2.15 Å

PDB Description: the structure of the open conformation of a flavocytochrome c3 fumarate reductase

PDB Compounds: (D:) flavocytochrome c3 fumarate reductase

SCOPe Domain Sequences for d1qo8d2:

Sequence; same for both SEQRES and ATOM records:

>d1qo8d2 c.3.1.4 (D:103-359,D:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
dgwdqdkiqkaiaagpsettqvlvvgagsagfnaslaakkaganvilvdkapfsggnsmi
saggmnavgtkqqtahgvedkvewfiedamkggrqqndiklvtilaeqsadgvqwleslg
anlddlkrsggarvdrthrphggkssgpeiidtlrkaakeqgidtrlnsrvvklvvnddh
svvgavvhgkhtgyymigaksvvlatggygmnkemiayyrptmkdmtssnnitatgdgvl
makeigasmtdidwvqaXainttasvldlqskpidglfaagevtggvhgynrlggnaiad
tvvfgriagdnaakhald

Timeline for d1qo8d2:

• d1qo8d2 first appeared (with stable ids) in SCOP 1.55
  
• d1qo8d2 appears in SCOPe 2.06
  
• d1qo8d2 appears in the current release, SCOPe 2.08