SCOPe 2.07: Domain d1qo8a1: 1qo8 A:2-102

Lineage for d1qo8a1 (1qo8 A:2-102)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)

7. Species Shewanella frigidimarina [TaxId:56812] [48722] (16 PDB entries)

8. Domain d1qo8a1: 1qo8 A:2-102 [19696]
   Other proteins in same PDB: d1qo8a2, d1qo8a3, d1qo8d2, d1qo8d3
   complexed with fad, hem

Details for d1qo8a1

PDB Entry: 1qo8, 2.15 Å

PDB Description: the structure of the open conformation of a flavocytochrome c3 fumarate reductase

PDB Compounds: (A:) flavocytochrome c3 fumarate reductase

SCOPe Domain Sequences for d1qo8a1:

Sequence; same for both SEQRES and ATOM records:

>d1qo8a1 a.138.1.3 (A:2-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}
tpdmgsfhadmgscqschakpikvtdsethenaqckschgeyaelandklqfdphnshlg
dinctschkgheepkfycnechsfdikpmpfsdakkkkswd

Timeline for d1qo8a1:

• d1qo8a1 first appeared (with stable ids) in SCOP 1.55
  
• d1qo8a1 appears in SCOPe 2.06
  
• d1qo8a1 appears in the current release, SCOPe 2.08