Lineage for d1f8sb1 (1f8s B:5-319,B:433-486)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096570Protein L-aminoacid oxidase [51929] (2 species)
  7. 2096576Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [51930] (3 PDB entries)
  8. 2096586Domain d1f8sb1: 1f8s B:5-319,B:433-486 [30415]
    Other proteins in same PDB: d1f8sa2, d1f8sb2, d1f8sc2, d1f8sd2, d1f8se2, d1f8sf2, d1f8sg2, d1f8sh2
    complexed with be2, fad, nag

Details for d1f8sb1

PDB Entry: 1f8s (more details), 2 Å

PDB Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.
PDB Compounds: (B:) l-amino acid oxidase

SCOPe Domain Sequences for d1f8sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8sb1 c.3.1.2 (B:5-319,B:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
nppllpkkahalrsvXftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglra
ardvnlasen

SCOPe Domain Coordinates for d1f8sb1:

Click to download the PDB-style file with coordinates for d1f8sb1.
(The format of our PDB-style files is described here.)

Timeline for d1f8sb1: