Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
Protein L-aminoacid oxidase [54397] (2 species) |
Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [54398] (3 PDB entries) |
Domain d1f8sc2: 1f8s C:320-432 [37980] Other proteins in same PDB: d1f8sa1, d1f8sb1, d1f8sc1, d1f8sd1, d1f8se1, d1f8sf1, d1f8sg1, d1f8sh1 complexed with be2, fad, nag |
PDB Entry: 1f8s (more details), 2 Å
SCOPe Domain Sequences for d1f8sc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f8sc2 d.16.1.5 (C:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} hyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftngvgviiaygigddan ffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldkyamggitt
Timeline for d1f8sc2: