Lineage for d2jywa_ (2jyw A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2525734Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2525970Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2525996Protein APOBEC3G (ARCD) [310757] (2 species)
  7. 2525997Species Human (Homo sapiens) [TaxId:9606] [311012] (2 PDB entries)
  8. 2525998Domain d2jywa_: 2jyw A: [304148]
    complexed with zn

Details for d2jywa_

PDB Entry: 2jyw (more details)

PDB Description: solution structure of c-terminal domain of apobec3g
PDB Compounds: (A:) DNA dC->dU-editing enzyme APOBEC-3G

SCOPe Domain Sequences for d2jywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jywa_ c.97.1.6 (A:) APOBEC3G (ARCD) {Human (Homo sapiens) [TaxId: 9606]}
dpptftfnfnnepwvrgrhetylcyevermhndtwvklnqrrgflanqaphkhgflegrh
aelcfldvipfwkldldqdyrvtcftswspcfscaqemakfisknkhvslciktariydd
qgraqeglrtlaeagakisimtysefkhcwdtfvdhqgapfqpwdgldehsqdlsgrlra
ilqnqen

SCOPe Domain Coordinates for d2jywa_:

Click to download the PDB-style file with coordinates for d2jywa_.
(The format of our PDB-style files is described here.)

Timeline for d2jywa_: