Lineage for d1f8rd1 (1f8r D:4-319,D:433-486)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meanderSuperfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) 
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
C-terminal domain is alpha+beta is common for the family
Protein L-aminoacid oxidase [51929] (2 species) Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [51930] (3 PDB entries) 
Domain d1f8rd1: 1f8r D:4-319,D:433-486 [30413]
Other proteins in same PDB: d1f8ra2, d1f8rb2, d1f8rc2, d1f8rd2
complexed with cit, fad, nag
Details for d1f8rd1
PDB Entry: 1f8r (more details), 2 Å
PDB Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma complexed with citrate
PDB Compounds: (D:) l-amino acid oxidaseSCOPe Domain Sequences for d1f8rd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f8rd1 c.3.1.2 (D:4-319,D:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
rnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvle
aserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfi
knirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydty
stkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdkl
ptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlik
fnppllpkkahalrsvXftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglr
aardvnlasen
SCOPe Domain Coordinates for d1f8rd1:
Click to download the PDB-style file with coordinates for d1f8rd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f8rd1:
View in 3D
