Lineage for d1f8rd1 (1f8r D:4-319,D:433-486)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20809Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins)
  6. 20826Protein L-amino acid oxidase [51929] (1 species)
  7. 20827Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [51930] (2 PDB entries)
  8. 20831Domain d1f8rd1: 1f8r D:4-319,D:433-486 [30413]
    Other proteins in same PDB: d1f8ra2, d1f8rb2, d1f8rc2, d1f8rd2

Details for d1f8rd1

PDB Entry: 1f8r (more details), 2 Å

PDB Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma complexed with citrate

SCOP Domain Sequences for d1f8rd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8rd1 c.3.1.2 (D:4-319,D:433-486) L-amino acid oxidase {Malayan pit viper (Calloselasma rhodostoma)}
rnplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvle
aserpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfi
knirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydty
stkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdkl
ptamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlik
fnppllpkkahalrsvXftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglr
aardvnlasen

SCOP Domain Coordinates for d1f8rd1:

Click to download the PDB-style file with coordinates for d1f8rd1.
(The format of our PDB-style files is described here.)

Timeline for d1f8rd1: