Lineage for d2jfdc3 (2jfd C:491-616,C:681-806)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101353Fold c.19: FabD/lysophospholipase-like [52150] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 432156; strand 4 is antiparallel to the rest
  4. 2101354Superfamily c.19.1: FabD/lysophospholipase-like [52151] (3 families) (S)
  5. 2101355Family c.19.1.1: FabD-like [52152] (4 protein domains)
    the superfamily common core covers almost all of the family fold
  6. 2101364Protein Catalytic domain from acyl transferase MAT [310774] (1 species)
  7. 2101365Species Human (Homo sapiens) [TaxId:9606] [311030] (1 PDB entry)
  8. 2101368Domain d2jfdc3: 2jfd C:491-616,C:681-806 [304122]
    Other proteins in same PDB: d2jfda1, d2jfda2, d2jfda4, d2jfda5, d2jfdb1, d2jfdb2, d2jfdb4, d2jfdb5, d2jfdc1, d2jfdc2, d2jfdc4, d2jfdc5, d2jfdd1, d2jfdd2, d2jfdd4, d2jfdd5

Details for d2jfdc3

PDB Entry: 2jfd (more details), 2.81 Å

PDB Description: Structure of the MAT domain of human FAS
PDB Compounds: (C:) fatty acid synthase

SCOPe Domain Sequences for d2jfdc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfdc3 c.19.1.1 (C:491-616,C:681-806) Catalytic domain from acyl transferase MAT {Human (Homo sapiens) [TaxId: 9606]}
plwficsgmgtqwrgmglslmrldrfrdsilrsdeavkpfglkvsqlllstdestfddiv
hsfvsltaiqiglidllscmglrpdgivghslgevacgyadgclsqeeavlaaywrgqci
keahlpXafhsyfmeaiappllqelkkvirepkprsarwlstsipeaqwhsslartssae
ynvnnlvspvlfqealwhvpehavvleiaphallqavlkrglkpsctiiplmkkdhrdnl
efflagigrlhls

SCOPe Domain Coordinates for d2jfdc3:

Click to download the PDB-style file with coordinates for d2jfdc3.
(The format of our PDB-style files is described here.)

Timeline for d2jfdc3:

  • d2jfdc3 is new in SCOPe 2.06-stable