Lineage for d2jfdc1 (2jfd C:422-490)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012150Fold d.390: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310562] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers; order 123
  4. 3012151Superfamily d.390.1: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310590] (1 family) (S)
    Pfam PF16197
  5. 3012152Family d.390.1.1: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310637] (2 proteins)
  6. 3012153Protein Acyltransferase domain N-terminal linker [310770] (2 species)
  7. 3012154Species Human (Homo sapiens) [TaxId:9606] [311026] (1 PDB entry)
  8. 3012157Domain d2jfdc1: 2jfd C:422-490 [304120]
    Other proteins in same PDB: d2jfda2, d2jfda3, d2jfda4, d2jfda5, d2jfdb2, d2jfdb3, d2jfdb4, d2jfdb5, d2jfdc2, d2jfdc3, d2jfdc4, d2jfdc5, d2jfdd2, d2jfdd3, d2jfdd4, d2jfdd5

Details for d2jfdc1

PDB Entry: 2jfd (more details), 2.81 Å

PDB Description: structure of the mat domain of human fas
PDB Compounds: (C:) fatty acid synthase

SCOPe Domain Sequences for d2jfdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfdc1 d.390.1.1 (C:422-490) Acyltransferase domain N-terminal linker {Human (Homo sapiens) [TaxId: 9606]}
rllrasgrtpeavqklleqglrhsqdlaflsmlndiaavpatampfrgyavlggerggpe
vqqvpager

SCOPe Domain Coordinates for d2jfdc1:

Click to download the PDB-style file with coordinates for d2jfdc1.
(The format of our PDB-style files is described here.)

Timeline for d2jfdc1: