Lineage for d2jfda2 (2jfd A:617-680)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855172Fold c.19: FabD/lysophospholipase-like [52150] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 432156; strand 4 is antiparallel to the rest
  4. 2855173Superfamily c.19.1: FabD/lysophospholipase-like [52151] (3 families) (S)
  5. 2855174Family c.19.1.1: FabD-like [52152] (4 proteins)
    the superfamily common core covers almost all of the family fold
  6. 2855196Protein Ferredoxin-like domain from acyl transferase MAT [310772] (2 species)
  7. 2855197Species Human (Homo sapiens) [TaxId:9606] [311028] (1 PDB entry)
  8. 2855198Domain d2jfda2: 2jfd A:617-680 [304111]
    Other proteins in same PDB: d2jfda1, d2jfda3, d2jfda4, d2jfda5, d2jfdb1, d2jfdb3, d2jfdb4, d2jfdb5, d2jfdc1, d2jfdc3, d2jfdc4, d2jfdc5, d2jfdd1, d2jfdd3, d2jfdd4, d2jfdd5
    fragment; missing more than one-third of the common structure and/or sequence

Details for d2jfda2

PDB Entry: 2jfd (more details), 2.81 Å

PDB Description: structure of the mat domain of human fas
PDB Compounds: (A:) fatty acid synthase

SCOPe Domain Sequences for d2jfda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfda2 c.19.1.1 (A:617-680) Ferredoxin-like domain from acyl transferase MAT {Human (Homo sapiens) [TaxId: 9606]}
pgamaavglsweeckqrcppgvvpachnskdtvtisgpqapvfefveqlrkegvfakevr
tggm

SCOPe Domain Coordinates for d2jfda2:

Click to download the PDB-style file with coordinates for d2jfda2.
(The format of our PDB-style files is described here.)

Timeline for d2jfda2: