Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.19: FabD/lysophospholipase-like [52150] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 432156; strand 4 is antiparallel to the rest |
Superfamily c.19.1: FabD/lysophospholipase-like [52151] (3 families) |
Family c.19.1.1: FabD-like [52152] (4 proteins) the superfamily common core covers almost all of the family fold |
Protein Ferredoxin-like domain from acyl transferase MAT [310772] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [311028] (1 PDB entry) |
Domain d2jfda2: 2jfd A:617-680 [304111] Other proteins in same PDB: d2jfda1, d2jfda3, d2jfda4, d2jfda5, d2jfdb1, d2jfdb3, d2jfdb4, d2jfdb5, d2jfdc1, d2jfdc3, d2jfdc4, d2jfdc5, d2jfdd1, d2jfdd3, d2jfdd4, d2jfdd5 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2jfd (more details), 2.81 Å
SCOPe Domain Sequences for d2jfda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfda2 c.19.1.1 (A:617-680) Ferredoxin-like domain from acyl transferase MAT {Human (Homo sapiens) [TaxId: 9606]} pgamaavglsweeckqrcppgvvpachnskdtvtisgpqapvfefveqlrkegvfakevr tggm
Timeline for d2jfda2:
View in 3D Domains from same chain: (mouse over for more information) d2jfda1, d2jfda3, d2jfda4, d2jfda5 |