SCOPe 2.07: Domain d2hg4c6: 2hg4 C:550-677,C:742-869

Lineage for d2hg4c6 (2hg4 C:550-677,C:742-869)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.19: FabD/lysophospholipase-like [52150] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 432156; strand 4 is antiparallel to the rest

4. Superfamily c.19.1: FabD/lysophospholipase-like [52151] (3 families)

5. Family c.19.1.1: FabD-like [52152] (4 proteins)
   the superfamily common core covers almost all of the family fold

6. Protein Catalytic domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) [310773] (1 species)

7. Species Saccharopolyspora erythraea [TaxId:1836] [311029] (1 PDB entry)

8. Domain d2hg4c6: 2hg4 C:550-677,C:742-869 [303988]
   Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a5, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c5, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e5, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f7
   complexed with act, cl, so4

Details for d2hg4c6

PDB Entry: 2hg4, 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.

PDB Compounds: (C:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4c6:

Sequence; same for both SEQRES and ATOM records:

>d2hg4c6 c.19.1.1 (C:550-677,C:742-869) Catalytic domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
rrgvamvfpgqgaqwqgmardllresqvfadsirdceralaphvdwsltdllsgarpldr
vdvvqpalfavmvslaalwrshgvepaavvghsqgeiaaahvagaltledaaklvavrsr
vlrrlggqXyashspqveslreelltelagispvsadvalystttgqpidtatmdtaywy
anlreqvrfqdatrqlaeagfdafvevsphpvltvgieatldsalpadagacvvgtlrrd
rggladfhtalgeayaq

Timeline for d2hg4c6:

• d2hg4c6 first appeared in SCOPe 2.06
  
• d2hg4c6 appears in the current release, SCOPe 2.08