SCOPe 2.07: Domain d2hg4a4: 2hg4 A:466-549

Lineage for d2hg4a4 (2hg4 A:466-549)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.390: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310562] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers; order 123

4. Superfamily d.390.1: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310590] (1 family)
   Pfam PF16197

5. Family d.390.1.1: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310637] (2 proteins)

6. Protein KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS) [310769] (1 species)

7. Species Saccharopolyspora erythraea [TaxId:1836] [311025] (1 PDB entry)

8. Domain d2hg4a4: 2hg4 A:466-549 [303972]
   Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c5, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f5, d2hg4f6, d2hg4f7
   complexed with act, cl, so4

Details for d2hg4a4

PDB Entry: 2hg4, 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.

PDB Compounds: (A:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4a4:

Sequence; same for both SEQRES and ATOM records:

>d2hg4a4 d.390.1.1 (A:466-549) KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
gpvplvlsgrdeqamraqagrladhlareprnslrdtgftlatrrsawehravvvgdrde
alaglravadgriadrtatgqart

Timeline for d2hg4a4:

• d2hg4a4 first appeared in SCOPe 2.06
  
• d2hg4a4 appears in the current release, SCOPe 2.08