Lineage for d2gdba_ (2gdb A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209320Protein Hypothetical protein AT1g77540 [118064] (1 species)
  7. 2209321Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118065] (6 PDB entries)
    Uniprot Q8LEN2
  8. 2209325Domain d2gdba_: 2gdb A: [303926]
    automated match to d2evna1
    complexed with coa

Details for d2gdba_

PDB Entry: 2gdb (more details), 2.06 Å

PDB Description: X-ray structure of At1g77540-Coenzyme A Complex
PDB Compounds: (A:) Protein At1g77540

SCOPe Domain Sequences for d2gdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdba_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
asshsisiipscsyvsdtflprnpswkplih

SCOPe Domain Coordinates for d2gdba_:

Click to download the PDB-style file with coordinates for d2gdba_.
(The format of our PDB-style files is described here.)

Timeline for d2gdba_: