Class g: Small proteins [56992] (100 folds) |
Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily) dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888) |
Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) |
Family g.85.1.1: MYND zinc finger [144233] (4 proteins) Pfam PF01753 |
Protein automated matches [254618] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255523] (3 PDB entries) |
Domain d2fv6a_: 2fv6 A: [303893] automated match to d4a24a_ complexed with zn |
PDB Entry: 2fv6 (more details)
SCOPe Domain Sequences for d2fv6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fv6a_ g.85.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} scvncgreamsectgchkvnycstfcqrkdwkdhqhicgqsa
Timeline for d2fv6a_: