PDB entry 2fv6

View 2fv6 on RCSB PDB site
Description: Solution structure of the MYND domain
Class: transcription
Keywords: Zinc finger domain
Deposited on 2006-01-30, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-12-25, with a file datestamp of 2007-12-21.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deformed epidermal autoregulatory factor 1 homolog
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fv6a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fv6A (A:)
    gamdaerkeqscvncgreamsectgchkvnycstfcqrkdwkdhqhicgqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fv6A (A:)
    scvncgreamsectgchkvnycstfcqrkdwkdhqhicgqsa